Protein Info for Psest_1637 in Pseudomonas stutzeri RCH2

Annotation: transcriptional regulator, ArgP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR03298: transcriptional regulator, ArgP family" amino acids 3 to 293 (291 residues), 365 bits, see alignment E=1.2e-113 PF00126: HTH_1" amino acids 6 to 63 (58 residues), 67.2 bits, see alignment E=1e-22 PF03466: LysR_substrate" amino acids 103 to 289 (187 residues), 39.5 bits, see alignment E=4.2e-14

Best Hits

Swiss-Prot: 40% identical to ARGP_KLEP7: HTH-type transcriptional regulator ArgP (argP) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 97% identity to psa:PST_2672)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK75 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Psest_1637 transcriptional regulator, ArgP family (Pseudomonas stutzeri RCH2)
MNLDPKQTEAFRTVIRTGSFEQAAQRLHLTPPAISQRVRALESALGSALVVRSRPCRPTE
TGQRLLQYLKRATLLEADLLADLAERSDAPLVVVAALNADSLGTWFFPALAEVLIRERVL
LDLTVEDQDHTYSLLETGLAIGCISTEPKPMRGCTASPLGSMRYRLVASSEFRQKHFAHG
LTRNAARKAPVVAYTRKDTLQSSFLLRRFGLPEGAYPCHFVPGAEPHFSAIRYGLGYGMV
PELLLHDALSAGEVVDLAPDEPLEIALYWHTWKVQSPRMEHLSRQIIDAAPKILARP