Protein Info for Psest_1636 in Pseudomonas stutzeri RCH2

Updated annotation (from data): putative transporter, required for glycine utilization
Rationale: PFam PF03458.9 (UPF0126). conserved specific phenotype of UPF0126
Original annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details PF03458: Gly_transporter" amino acids 7 to 79 (73 residues), 74 bits, see alignment E=3.6e-25 amino acids 92 to 164 (73 residues), 72.8 bits, see alignment E=8.2e-25

Best Hits

Swiss-Prot: 47% identical to Y1240_HAEIN: UPF0126 membrane protein HI_1240 (HI_1240) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 98% identity to psa:PST_2673)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJK6 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Psest_1636 putative transporter, required for glycine utilization (Pseudomonas stutzeri RCH2)
MELLHTIYLIAITAEAMSGAIMGMRRGMDLFGICLLGTVTALGGGTARDVLLGHYPVGWI
AHPEYLTFTIGAAIVTGFIARHLHHLRMVFLLVDGLGLVAFTVIGCDVAMGMGAHPSIVV
LAGVITGIFGGLMRDVLCNQVPMVLQRELYATVALFTGVFYVGMLWLEINTTLATLAALG
SGFLFRVLAMTFHWKLPDFNGKEIRGLD