Protein Info for PGA1_c16210 in Phaeobacter inhibens DSM 17395

Annotation: iron-sulfur cluster binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 10 to 63 (54 residues), 29.2 bits, E=7.1e-11
• PF01799: Fer2_2
  • amino acids 77 to 149 (73 residues), 105.7 bits, E=1.1e-34

Best Hits

Swiss-Prot: 46% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: None (inferred from 87% identity to sil:SPOA0413)

MetaCyc: 49% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (10/11 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• L-arabinose degradation IV (4/8 steps found)
• D-xylose degradation IV (3/7 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)
• superpathway of pentose and pentitol degradation (11/42 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See I7DQK1 at UniProt or InterPro

Protein Sequence (160 amino acids)

>PGA1_c16210 iron-sulfur cluster binding domain-containing protein (Phaeobacter inhibens DSM 17395)
MSSKIHVSATINGDAVDYLCDPRETLLDVLRDRLNLTGAKEGCGTGDCGACSITLNGRLV
CSCLVLGVEAEGQEIATVEGIAPGETLHPLQQKFIDHAALQCGICTPGILVAAKALLEKN
PDPTETEVRYWLAGNLCRCTGYDKIIRAVMDAAAEMREAS