Protein Info for Psest_1634 in Pseudomonas stutzeri RCH2

Annotation: tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 PF05430: Methyltransf_30" amino acids 118 to 238 (121 residues), 144.1 bits, see alignment E=4.2e-46 TIGR03197: tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain" amino acids 265 to 659 (395 residues), 456.3 bits, see alignment E=4.8e-141 PF01266: DAO" amino acids 265 to 630 (366 residues), 187.5 bits, see alignment E=1e-58 PF13450: NAD_binding_8" amino acids 267 to 296 (30 residues), 25 bits, see alignment (E = 3.9e-09)

Best Hits

Swiss-Prot: 86% identical to MNMC_PSEU5: tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC (mnmC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 86% identity to psa:PST_2675)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLI0 at UniProt or InterPro

Protein Sequence (660 amino acids)

>Psest_1634 tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain (Pseudomonas stutzeri RCH2)
MNDHPAPDTFQHAELDWDENGLPQSRQYGDVYFSRASGLAETEHVFLAQNELARRFAALQ
SNQHLVIGETGFGTGLNFLCAWQLFERTADAQAHLHFVSVEKHPLNHDDMQRALALWPEL
QPQAAQLLQQYVALNPGFQRFVFAGGRVVLTLLIGDVLDCLPSLDARVDAWFLDGFAPAK
NPQMWQPALFAELARLSAPGATLGTFTSAGFVRRGLVEAGFDMQRVPGYGHKREILRGRL
LAVANPVSDKPWFARPNHGITERRAVVIGAGLAGCATAASLAARGWQVSVLERHAEAAQE
GSGNPQGVLYLKLSAHGTALSRLVVSGFSYTRRLLANLQAGQDWQACGVLQLCYDDKERE
RQAELAEAFPASLVHPLSHEAAEALAGVRLPAGGLFYPDAGWANPPALCHWLLQQPGIEL
LQHHEALELQRNGQSWQVLAGEKVLADAPVVVLAGAADAARFSQSAWLPLKRIRGQISCL
PANAESGQLRTVLCAKGYVAPPRDGTHTLGASFNFQQTDDAPSIAEHQANLEMLEQISSD
LYQRLQADPQQTAALQGRVAFRCTSPDYLPLIGPLAEPQAFADTYAALAKNARQSQHAAC
PWLEGLYVNTAHGSRGMISAPLSGELLAAWLNDEPLPLPREVAEACHPNRFLLRKLIRGS