Protein Info for PGA1_c16110 in Phaeobacter inhibens DSM 17395

Annotation: putative ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details PF07885: Ion_trans_2" amino acids 66 to 135 (70 residues), 37.6 bits, see alignment E=8.2e-14

Best Hits

KEGG orthology group: None (inferred from 53% identity to sit:TM1040_1179)

Predicted SEED Role

"FIG01031683: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQJ6 at UniProt or InterPro

Protein Sequence (149 amino acids)

>PGA1_c16110 putative ion channel (Phaeobacter inhibens DSM 17395)
MTLIQQLLMGSLYLGICLVVEAGLLVFCIHILRERLGILQRGRRFLQISVVLAVAIGLIV
FAHTLQVWIWATALIFSGAIGDWNTAIYFSLATYTTLGYGDIVLGEGMRIFAAFGAVTGL
FAFGISTAFLVAALREVFLLEETAPVKDR