Protein Info for PGA1_c16100 in Phaeobacter inhibens DSM 17395

Annotation: putative cardiolipin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 29 to 472 (444 residues), 358 bits, see alignment E=4.7e-111 PF13091: PLDc_2" amino acids 126 to 235 (110 residues), 35.1 bits, see alignment E=1.1e-12 amino acids 315 to 440 (126 residues), 107.4 bits, see alignment E=4.9e-35 PF00614: PLDc" amino acids 210 to 236 (27 residues), 29.1 bits, see alignment (E = 7.1e-11) amino acids 388 to 413 (26 residues), 32.2 bits, see alignment (E = 7.8e-12)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 56% identity to sil:SPO2178)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZD7 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PGA1_c16100 putative cardiolipin synthetase (Phaeobacter inhibens DSM 17395)
MVEVVISTSALLLMWGLAGLASLKAARTARTPQGAIGWVVFLLSAPLLALPLYLFFGQRK
FSRYRATRCEAERVLNALRVYSTRYTQDRDQLAVNQAPFERLAGYPVCRGNSFELLINGT
DISDAIIDAIDAAEDYVLVHFYIVRDDQIGQRLKSALLRARERGVAVWFMTDAVGSHGLS
QQYRADLDAAGVNQVDPSTRPGPKHRFHLNFRNHRKTVIVDGRVGFTGGMNIGDEYMGRD
PKFGDWRDTQVRLRGPAVQQLQLGYAEDWFWLTEDPILDLLTWECAPVSEGGKPALVIET
GPGDSTVNGSMLYFSAIAAAQSRIWLSSPYFVPDQDVMAALKNAALRGVDVRILLPDTAD
HYAPWLAAYAYFDDLRDVGIDIYRYQAGFLHQKVFVVDDSIAAVGTMNLDNRSFRLNFES
MALCFDSEAADQVADMLEQDMASARLLTTDLEAQPLSIRFGAPVARLLAPVL