Protein Info for PGA1_c16080 in Phaeobacter inhibens DSM 17395

Annotation: ribosomal RNA large subunit methyltransferase J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01728: FtsJ" amino acids 58 to 241 (184 residues), 182.7 bits, see alignment E=3.5e-58

Best Hits

Swiss-Prot: 90% identical to RLME_RUEST: Ribosomal RNA large subunit methyltransferase E (rlmE) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 90% identity to sit:TM1040_1182)

Predicted SEED Role

"Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EM62 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PGA1_c16080 ribosomal RNA large subunit methyltransferase J (Phaeobacter inhibens DSM 17395)
MAKTPTGKTPTGKNTSGRGQRDLKVKVKTARGRKLSSTRWLQRQLNDPYVKRAQAEGYRG
RAAYKIMEVDDKFRFLINGARVVDLGCAPGGWAQVAVKRINALGEKPGKAVGRIIGVDLQ
EVEPLAGAEFHQLDFMDDGADDKVKEWLGGKADVVMSDMAAASSGHKQTDHLRIISLCET
AAYFAFDVLEDGGTFVAKVLAGGAEGELQKLLKQKFTKVYHVKPPSSRSDSSEKFVVATG
FRGDASDAAED