Protein Info for PGA1_c16040 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Methionine synthase component, pterin-binding domain (EC:2.1.1.13)
Rationale: Its auxotrophic phenotype is rescued by methionine. PGA1_c16040 has the pterin-binding domain (auxotroph)
Original annotation: pterin binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00809: Pterin_bind
  • amino acids 25 to 254 (230 residues), 92.8 bits, E=2.8e-30
• PF03599: CdhD
  • amino acids 80 to 210 (131 residues), 36.6 bits, E=2.3e-13

Best Hits

KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 93% identity to sit:TM1040_1186)

MetaCyc: 100% identical to methionine synthase pterin binding subunit (Phaeobacter inhibens)
Methionine synthase. [EC: 2.1.1.13]

Predicted SEED Role

"Pterin-binding enzyme domain protein"

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• L-methionine salvage from L-homocysteine (2/3 steps found)
• folate transformations I (9/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13

Sequence Analysis Tools

See I7E0U3 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PGA1_c16040 Methionine synthase component, pterin-binding domain (EC:2.1.1.13) (Phaeobacter inhibens DSM 17395)
MTRTVVESKTKTAILGFDEPFCVIGERINPTGRKKLAAELEAGDFSTVEKDALAQVMAGA
NILDINAGVVYNSNPNPNETEPPLMTKIVELVQGLTDTPLCIDSSVPGALEAGLQAAEGR
PLLNSVTGEEERLEHVLPLVKKYNVPVVAISNDDTGISEDPDVRFAVAKKIVERAADFGI
PAHDIVVDPLVMPIGAMATAGQQVFALVRRLREELGVNTTCGASNVSFGLPNRHGINNAF
LPMAMGAGMTSAIMNPVALPITQKKIAEKKAEVEAAGIILPEGMEDEAFVQMFGLGSTKP
RAGKEMEAIRAANLLTNNDPHGGEWIKANKEPAKEGEEGRGRGGRAGGRRRRA