Protein Info for PGA1_c16000 in Phaeobacter inhibens DSM 17395

Annotation: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
  • amino acids 6 to 332 (327 residues), 254.8 bits, E=5.1e-80
• PF00132: Hexapep
  • amino acids 110 to 143 (34 residues), 31.5 bits, 1e-11
  • amino acids 127 to 161 (35 residues), 29.3 bits, 5e-11

Best Hits

Swiss-Prot: 75% identical to LPXD_RUEPO: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 75% identity to sit:TM1040_1219)

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (8/9 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (12/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (12/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

See I7DQJ0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PGA1_c16000 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (Phaeobacter inhibens DSM 17395)
MFTVREIATSLQAEAEGDLDLTVLRAAEPQDAGPDDLAMAMAPKYAESLDEGSARVGLVW
EGADWQAMGLQAAIFAPRPRLAMGGITRLLDPGQGFGPGVHPSAVIDPEAELGDGVCVGP
LAVIAAGARIGAGSVIGPQCYIGADVTLGRDAQLREGVSIGARATIGDRFRAQPGARVGG
DGFSYVTPEVSGVETARKTMGDQGETKAQSWLRIHSLGAVDIGNDVELGSNCTIDNGTIR
NTVIGSGSKLDNLVHVGHNTRVGKDCLLCGQTGISGSVDIGNNVVLGGQTGVADNIFIGD
GVIAGGGTKILSNVPAGRVVMGYPAVKMETHTEMYKGQRRLGRLMRDIEALKKAVFK