Protein Info for PGA1_c15960 in Phaeobacter inhibens DSM 17395

Annotation: Predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF05872: HerA_C" amino acids 15 to 510 (496 residues), 735.6 bits, see alignment E=4.4e-225 PF01935: DUF87" amino acids 23 to 162 (140 residues), 31.9 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 58% identical to YJGR_ECOLI: Uncharacterized protein YjgR (yjgR) from Escherichia coli (strain K12)

KEGG orthology group: K06915, (no description) (inferred from 81% identity to sit:TM1040_1223)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWY3 at UniProt or InterPro

Protein Sequence (514 amino acids)

>PGA1_c15960 Predicted ATPase (Phaeobacter inhibens DSM 17395)
MQDKLFIGGGGENYADPQALTLKYANRHGLIAGATGTGKTVTLQILAESFSNAGVPVILS
DVKGDLSGLAKSGSATHKLHDAFTSRADKIGFSDYSYHACPVTFWDLYGQQGHPVRTTVA
EMGPLLLARLLELSEAQEGILNIAFRLADEEGLALLDLKDLQALLVWVGENRAQLSLRYG
NVSTASIGAIQRRLLVLENQGGAQLFGEPALDLADLMRCTADGQGMVNILAADKLMAAPG
LYATFLLWLLSELFEELPEVGDPDKPKLVFFFDEAHLLFDDAPKALIDKVEQVARLIRSK
GVGIYFITQNPADVPEDILGQLGNRIQHALRAFTARDRRNLRMAAETYRENPRFSTEEAI
REVGVGEAVTSMLQKKGIPGVVERTLIRPPSSQLGPITAAERAAFLQTSDMAGKYDQTQD
RRSAYEILAERAAKAAAEAEVAEEAAEIAPEPMAREYNAGRRYSGSRVSRSSSRRMKPRD
SFASAMSEAVIKELKGTTGRRLVRGILGGLFKGR