Protein Info for PGA1_c15890 in Phaeobacter inhibens DSM 17395

Annotation: extracellular ligand-binding receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 26 to 327 (302 residues), 115.6 bits, see alignment E=4.1e-37 PF01094: ANF_receptor" amino acids 49 to 209 (161 residues), 77 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 82% identity to sit:TM1040_1272)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQI3 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PGA1_c15890 extracellular ligand-binding receptor (Phaeobacter inhibens DSM 17395)
MKKLMMATAAAALTAGTAFAGGHAKEVKLGVLLGFTGPIESLAPAMGAGAELAMEEVTKS
GKLLDSATVTPVRADTGCIDNGLSTANGEKLIADGVNGIIGGDCSGVTGAILQNVAIPNG
MVMISPSATSPGLSSMEDNDLFFRTSPSDAREGQVMAEVLKERGINSIALTYTNNDYGKG
LADAIKSSFEEVGGEVTIVTAHEDGKGDYSAEVAALASAGGDILVVAGYLDQGGLGIIQA
SLDSGAYDTFGLPGGMIGDSLPKNIGSDLDGSFGQIAGSDSEGAAIYAELAKAAGFDGTS
AYSPESYDAAALFMLAMQAANSKDPADYGSKILEVANAPGEKINPGELGKALEILANGGD
IDYEGATGVELIGPGESAGSYREIEVKDGANATVKFR