Protein Info for Psest_1601 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 24 (1 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 16 to 147 (132 residues), 30 bits, see alignment E=1.3e-10 PF26769: HAMP_PhoQ" amino acids 175 to 218 (44 residues), 32 bits, see alignment 2.5e-11 PF00512: HisKA" amino acids 227 to 287 (61 residues), 43.5 bits, see alignment E=6.5e-15 PF02518: HATPase_c" amino acids 342 to 439 (98 residues), 70.5 bits, see alignment E=4e-23 PF13581: HATPase_c_2" amino acids 342 to 434 (93 residues), 30.1 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2710)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJH6 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Psest_1601 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MSLRLRLTLMLGSAFVLLWALAATWMLVDLRSQMMLSLDQRLAASARMVAGLLVQLPQPL
PGDSSAKRLSAEQLGIPNGLACQVSSLRGEVLARSHSAPDQQLDAEGNGFRDQLIDGVPW
RSFTLVQGELRITTADRLDERAALKRSVLLAAALPVAVALLGSLGLLWLGLGRGLAPLQR
IRQALTRRGADSLEPLPLDGLPAELLPLVQTQNQLFQRISDAIERERRLTGDAAHELRSP
LTAIKTHLQVARMTEGAAAAQALANAEAGADRLQRTLEQLLLLARVEGSLDFDDGLQCSA
AEVARLAIQDANGGDGAPIQLQVPANLPAAPLAMPPVLAIAALRNLLENAQRHTAAGTSV
LLVLHGDDSRVRFEVHDQGPGIAAEHLQHLTRRFWRHTSSSGSGLGLAIVQAIAQRCDCT
LAFDSQPDGLRVSLTVPLQR