Protein Info for PGA1_c15760 in Phaeobacter inhibens DSM 17395

Annotation: putative phosphate transport system permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details PF11812: DUF3333" amino acids 29 to 181 (153 residues), 164.5 bits, see alignment E=2.1e-52 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 206 to 453 (248 residues), 209.7 bits, see alignment E=2.3e-66 PF00528: BPD_transp_1" amino acids 251 to 455 (205 residues), 64.7 bits, see alignment E=9.6e-22

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 84% identity to sit:TM1040_1260)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0S2 at UniProt or InterPro

Protein Sequence (456 amino acids)

>PGA1_c15760 putative phosphate transport system permease protein PstA (Phaeobacter inhibens DSM 17395)
MTDISQNTPGPNTAGSDARHAGSLLQQSERTRKRNAAERRFRGYGISAITVGLLMLAVLV
FTIVSRGTGAFQQTFITLDVELLESKLDKSGTRDLDAIKKVTTFGYAPLIKNAVQAKVAE
LGIDTDLKAKAMAGILSKNAAAQLRAYVVENPDQIGQTVTFRFLASSRVDGYLKGRVSRD
SIVNDKSISPAQLDLVDALVAAEVAAKTFNLDFITGADASDARPEAAGMGVSMMGSLFMM
LVVLALALPIGVAASIYLEEFAPKNWITDVIEVNISNLAAVPSIVFGILGLAVFINYMHL
PMSAPLVGGLVLTLMTLPTVIISTRASLKSVPPSIRDAALGVGASRMQAVFHHVLPLAAP
GILTGTIIGLAQALGETAPLLLIGMVGFIASNAPETIADGLLAPNSAMPAQIYEWAKRAD
PAFYERAWGGIIILLIFLVTMNTVAVILRRRFERRW