Protein Info for Psest_1586 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 90 to 109 (20 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details PF00126: HTH_1" amino acids 5 to 61 (57 residues), 65.6 bits, see alignment E=3.2e-22 PF03466: LysR_substrate" amino acids 87 to 294 (208 residues), 98 bits, see alignment E=5.3e-32

Best Hits

Swiss-Prot: 32% identical to ABGR_ECOLI: HTH-type transcriptional regulator AbgR (abgR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 64% identity to tmz:Tmz1t_1301)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJG3 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Psest_1586 Transcriptional regulator (Pseudomonas stutzeri RCH2)
MKDHQLKALIQVAESGSIRAAARAMNLSQSALTKALRELEEDVGAELLRRSYKGIGFTPA
GDALLVRARLAQATLDKAREEIRQLRGGAGARIAIALTPLVAATILPPILTEFRRVQPDA
ALSLEEGLLTYVLPGLLEGRLDFAVALASPSDLPHEIVFEPLVQAHAVPTGRLGHPLAHA
RSWDELKDASWVLNLTDGSLGNHLLRWLASQGIEAPKNIVRCSSLTLMLELMRRTDYIGF
GPTALLSDSLFAVGLQQFEVAPVPGPMTLGILSLRGVPLGSSAQVLARLFARRLRK