Protein Info for Psest_1580 in Pseudomonas stutzeri RCH2

Annotation: NAD(P)H:quinone oxidoreductase, type IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 2 to 197 (196 residues), 316 bits, see alignment E=6e-99 PF02525: Flavodoxin_2" amino acids 3 to 118 (116 residues), 28.2 bits, see alignment E=2.3e-10 PF03358: FMN_red" amino acids 3 to 147 (145 residues), 60.3 bits, see alignment E=2.6e-20 PF00258: Flavodoxin_1" amino acids 6 to 123 (118 residues), 38.9 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 79% identical to NQOR_MARHV: NAD(P)H dehydrogenase (quinone) (Maqu_3134) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 96% identity to psa:PST_2721)

MetaCyc: 76% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL55 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Psest_1580 NAD(P)H:quinone oxidoreductase, type IV (Pseudomonas stutzeri RCH2)
MAKILVLYHSMYGHIETMANAVAEGARRVPGAEVTIKRVPETMPEDAFRNAGGKVDQAAD
IADPNELPNYDAIIFGTPTRFGNMSGQMRNFLDRTGGLWAKGALHGKVASVFASTGTGGG
QEMTITSTWTTLAHHGMVIVPTGYGISEFFDISATNGGTPYGATTIAGGDGSRQPSEKEL
TIARYQGEHVAKITSKLVG