Protein Info for Psest_1579 in Pseudomonas stutzeri RCH2

Annotation: Pirin-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF02678: Pirin" amino acids 12 to 118 (107 residues), 115.1 bits, see alignment E=1.6e-37 PF17954: Pirin_C_2" amino acids 152 to 230 (79 residues), 68.7 bits, see alignment E=4e-23

Best Hits

Swiss-Prot: 69% identical to Y1210_PSEAE: Putative quercetin 2,3-dioxygenase PA1210 (PA1210) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06911, (no description) (inferred from 89% identity to psa:PST_2722)

Predicted SEED Role

"putative pirin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLC5 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Psest_1579 Pirin-related protein (Pseudomonas stutzeri RCH2)
MIERRSYAELGAAQHGWLNARHHFSFAGYHDAERMRWGRLRVWNDDSIAPQSGFEPHSHR
DMEIITYVRQGAITHEDSLGNRGRTVAGDVQVMSAGTGIVHSEYNLEDVETRIFQIWIHP
QQTGLPPAWGTRQFPTGERAGAFVTLASGLPGDDEALPIRAEARLAAATLAAGQSTDYEI
ADGRRVYLVPASGRIEVNGLEVAAGDGVAVRDEARLTIRAVEKSEIVLVESR