Protein Info for PGA1_c15610 in Phaeobacter inhibens DSM 17395

Annotation: alcohol dehydrogenase, zinc binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF08240: ADH_N" amino acids 27 to 87 (61 residues), 41.5 bits, see alignment E=1.5e-14 PF00107: ADH_zinc_N" amino acids 151 to 277 (127 residues), 89.5 bits, see alignment E=2.7e-29 PF13602: ADH_zinc_N_2" amino acids 184 to 328 (145 residues), 60.4 bits, see alignment E=5.6e-20

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 67% identity to sil:SPO1969)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZB1 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PGA1_c15610 alcohol dehydrogenase, zinc binding (Phaeobacter inhibens DSM 17395)
MHAMLSTAPGGPETLHWSAQECPEPGPQEVVVKIHAASVNYPDTLMIQDLYQIKPPRPFA
PGGEIAGEIIALGREVQDHKIGDRVLALTGYGGFATHIVIPAGAAIQIPDQMPYLDAAGF
VFTYGTSHHALKERANLQSGETVLVLGAAGGVGSAAVELAKAAGARVIAAVSSAEKAAFC
QEIGADATVIYGHAPDKEDQISFGKNIKALAGKAGVDVVYDAVGGPYAEPALRAMGWQGR
YLVVGFAAGIPKIPMNLPLLKGCQIVGVFWGAAVQRDPAQHLRNVGELFELYGSGKIRPR
VHATYPMSEAAAALTEMQNRNVLGKIILTNTPE