Protein Info for Psest_1574 in Pseudomonas stutzeri RCH2

Annotation: phenazine biosynthesis protein PhzF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00654: phenazine biosynthesis protein, PhzF family" amino acids 1 to 262 (262 residues), 117.4 bits, see alignment E=4.1e-38 PF02567: PhzC-PhzF" amino acids 8 to 259 (252 residues), 180.5 bits, see alignment E=2.5e-57

Best Hits

Swiss-Prot: 49% identical to Y2770_PSEAE: Uncharacterized isomerase PA2770 (PA2770) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06998, (no description) (inferred from 93% identity to psa:PST_2727)

Predicted SEED Role

"Phenazine biosynthesis protein PhzF like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLC1 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Psest_1574 phenazine biosynthesis protein PhzF family (Pseudomonas stutzeri RCH2)
MKLRMFQVDAFTAERFRGNPAAVIPLQAWLSDELMQAIAAENNLSETAFFVREADGAFHI
RWFSPLTEIDFCGHATLASAFVLLEQDLAQAPLVFRAAAVGDLSVQRRADGLLEMSFPNR
APDLVAEPPAALLQGLGCEPDAVLRNQQAWFAVYRDEQQVRMLTPDLDALRTLAPLDVVV
TAPGREQDFVSRYFWPANGGAEDPVTGSIHAGLAPYWAGQLGRNELVALQASARTGILHC
RVEADRVMVAGQAVLFLDGTIEL