Protein Info for Psest_1571 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase accessory protein FixG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 39 to 465 (427 residues), 539 bits, see alignment E=4.5e-166 PF12801: Fer4_5" amino acids 96 to 121 (26 residues), 24.6 bits, see alignment (E = 7e-09) PF13746: Fer4_18" amino acids 217 to 323 (107 residues), 148.4 bits, see alignment E=3.3e-47 PF11614: FixG_C" amino acids 352 to 466 (115 residues), 91.8 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_2730)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJF0 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Psest_1571 cytochrome c oxidase accessory protein FixG (Pseudomonas stutzeri RCH2)
MTDRIPAQIIETVDPSQPIRLTPAQSGGPIHTRSFSGRFRNLRLLGGALLMLLYFGTVWL
NWNGRQAVLWDLDRQQFHIFGATFWPQDFILLSAILIIAAFGLFFITVLAGRIWCGYACP
QSTWTWMFMWVEKLTEGDRLQRIKLDAAPWSPAKLLRRAAKHTLWLAISLATALAFVGYF
TPVRELVADLGRFDAGATTAFWLLFFTAATYINAGWLREQVCLHMCPYSRFQSVMFDADT
LLVSYDAARGENRGARRKGADPRAQGLGDCVDCTLCVQVCPTGIDIRDGLQLDCISCGAC
IDVCDSVMDRMGYARGLLRYSSERALKGGITRFFRPRLVGYAVALIAMIAAFVWALDARP
QLQLDVTRDRTLYRENMQGQIENMYRLKLINKTQQPRRYALGLEGGPFALQGPREIVLAP
GEIADLPVSVALLDNARDFSRELRFEVSDIAEPSSRVSTPSTFVAPIAALRQ