Protein Info for HP15_1497 in Marinobacter adhaerens HP15

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR03594: ribosome-associated GTPase EngA" amino acids 1 to 411 (411 residues), 522.7 bits, see alignment E=1.2e-160 PF01926: MMR_HSR1" amino acids 2 to 98 (97 residues), 52.2 bits, see alignment E=1.9e-17 amino acids 157 to 275 (119 residues), 90.4 bits, see alignment E=2.7e-29 TIGR00231: small GTP-binding protein domain" amino acids 156 to 319 (164 residues), 82.9 bits, see alignment E=3.4e-27 PF00009: GTP_EFTU" amino acids 157 to 321 (165 residues), 41.4 bits, see alignment E=3.8e-14 PF02421: FeoB_N" amino acids 157 to 295 (139 residues), 48.7 bits, see alignment E=1.9e-16 PF14714: KH_dom-like" amino acids 331 to 411 (81 residues), 99.6 bits, see alignment E=2.9e-32

Best Hits

Swiss-Prot: 91% identical to DER_MARHV: GTPase Der (der) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03977, GTP-binding protein (inferred from 91% identity to maq:Maqu_1131)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PL53 at UniProt or InterPro

Protein Sequence (452 amino acids)

>HP15_1497 GTP-binding protein EngA (Marinobacter adhaerens HP15)
MTRSRDALVADFPGLTRDRKYGEGSYEGQRFIVIDTGGLTGDEQGLDLEMARQSMQAVEE
ADIVLFLVDGRAGLTAGDELIADSLRRSGKQAHLVVNKTDGQDPDIAASDFYSLGFESTF
LIAASHNRGIRSMLEILLPSEEEREEEDRADRYPGIRIGVVGRPNVGKSTLVNRMLGEDR
VVVYDMPGTTRDSVYIPYERQGSQYTLIDTAGVRRRKNVSEVVEKFSIIKTLQAIDDAHV
VILVIDAREGLVDQDLHLIGFVLDAGRSLVIAVNKWDGMDPEDRARVKEQVQRRLDFLDY
ADKHYISALHGSGVGVMYESVQACYESAMAKWPTNRLTAILQDAIAQHQPPMVHGRRIKL
RYAHQGGSNPPVIVVHGNQVDSLPGAYKRYLENTFRKVLKVTGSPIRFEFKSGENPFAGK
VDRLTPRQKVKKDNDEKKGRRPKKQRQKSLKR