Protein Info for PGA1_c15500 in Phaeobacter inhibens DSM 17395

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR02729: Obg family GTPase CgtA" amino acids 3 to 325 (323 residues), 452.7 bits, see alignment E=6.6e-140 PF01018: GTP1_OBG" amino acids 5 to 158 (154 residues), 206.8 bits, see alignment E=2.7e-65 PF01926: MMR_HSR1" amino acids 161 to 280 (120 residues), 90.5 bits, see alignment E=1.7e-29 TIGR00231: small GTP-binding protein domain" amino acids 161 to 318 (158 residues), 45.8 bits, see alignment E=5.7e-16 PF02421: FeoB_N" amino acids 162 to 320 (159 residues), 45.5 bits, see alignment E=1.2e-15 PF00025: Arf" amino acids 164 to 324 (161 residues), 25.1 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 85% identical to OBG_RUEST: GTPase Obg (obg) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03979, GTP-binding protein (inferred from 85% identity to sit:TM1040_1203)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0P8 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PGA1_c15500 GTP-binding protein (Phaeobacter inhibens DSM 17395)
MKFLDLAKVYIRSGAGGNGCVSFRREKFMEYGGPDGGDGGRGGSVWVEVTEGLNTLIDFR
YQQHFFAKNGQSGMGRQRTGKDGDDIILRVPVGTEIMDEDQETVLADLTEVGERFLLAKG
GNGGFGNLHFKSATNQAPRRANSGQDAIERTIWLRLKLIADVGLLGLPNAGKSTFLSATS
NARPKIADYPFTTLHPNLGVVGIDGVEFVVADIPGLIAGAHEGRGIGDRFLGHVERCAVL
LHLVDGTSETVAEDYQTIINELEAYGGELAEKPRITALNKIDSLDDEERAEAKAALEAAV
GGPVFMMSGVSREGLNEVLRSMRTQIDEDRLRQQPQEEQDTWQP