Protein Info for PGA1_c15480 in Phaeobacter inhibens DSM 17395
Annotation: 50S ribosomal protein L27
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to RL27_RUEST: 50S ribosomal protein L27 (rpmA) from Ruegeria sp. (strain TM1040)
KEGG orthology group: K02899, large subunit ribosomal protein L27 (inferred from 92% identity to sit:TM1040_1201)MetaCyc: 65% identical to 50S ribosomal subunit protein L27 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L27p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7EWU0 at UniProt or InterPro
Protein Sequence (89 amino acids)
>PGA1_c15480 50S ribosomal protein L27 (Phaeobacter inhibens DSM 17395) MAHKKAGGSSRNGRDSAGRRLGVKLYGGQAAISGNIIVRQRGTKFWPGEGVGLGKDHTIF ATTDGAVTFHKGLKGRTFISVLPVAEAAE