Protein Info for PGA1_c15470 in Phaeobacter inhibens DSM 17395

Annotation: 50S ribosomal protein L21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00829: Ribosomal_L21p" amino acids 1 to 101 (101 residues), 124 bits, see alignment E=1.3e-40 TIGR00061: ribosomal protein bL21" amino acids 2 to 101 (100 residues), 106.5 bits, see alignment E=4.1e-35

Best Hits

Swiss-Prot: 86% identical to RL21_RUEST: 50S ribosomal protein L21 (rplU) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 86% identity to sit:TM1040_1200)

Predicted SEED Role

"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQE6 at UniProt or InterPro

Protein Sequence (196 amino acids)

>PGA1_c15470 50S ribosomal protein L21 (Phaeobacter inhibens DSM 17395)
MFAVLKTGGKQYKVQAGDMLRVEKLAADAGETIQFNDVLMLGGDAPVVGAPFVDGAAVQA
EVVDQIKGEKVIHFVKRRRKHSSKRTKGHRQKLTLVKITEILASGADKSGVKAASGQGDA
PAAKAAPAAKKAAPAASGDNLTELTGVGPAAAKKLEEAGLTSFAQIAALSDADIAAIDAV
KVKPEWVEQAKELAKG