Protein Info for Psest_1551 in Pseudomonas stutzeri RCH2

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details PF01027: Bax1-I" amino acids 21 to 216 (196 residues), 98.7 bits, see alignment E=2e-32

Best Hits

KEGG orthology group: None (inferred from 71% identity to spc:Sputcn32_0129)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJD3 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Psest_1551 Integral membrane protein, interacts with FtsH (Pseudomonas stutzeri RCH2)
MENPVFARRSSPLDRTLSAGAYNLVIGLTLCWGFWVNWWMVGNIPVESIRSTHPWLFVGG
YFASCLTGAWLFHRSNKPWVSFLGYNLVVVPFGLVVNLVVSRYDSALVHEAIRITALVTL
GMMLLGTLFPRFFASIARALTVALLLVIVVELVELFILGIHHGVIDWIVVLIFCGYVGVD
WGRANQIPKTLDNAIDSAAALYMDIINLFLRILRILGRK