Protein Info for Psest_1550 in Pseudomonas stutzeri RCH2

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR02421: conserved hypothetical protein" amino acids 21 to 412 (392 residues), 435 bits, see alignment E=1.3e-134 PF08014: MATCAP" amino acids 43 to 416 (374 residues), 452.4 bits, see alignment E=5.6e-140

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_2753)

Predicted SEED Role

"FIG00953322: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL29 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Psest_1550 conserved hypothetical protein (Pseudomonas stutzeri RCH2)
MNTRNNLDEYQSIVRALSDRIVEAQTPVRVLDAVKWDESTRQGFFATKGRELPKIDRGYY
EGRPLAFDSSAKKQEFQDIERDITRQLGQFNPVGQIMRRMCKEYRMVIRMLEARGTPDFG
MISQELYGAASDAFHAGDPTLADLGLMLSDYLNNIADRGDLRDEPKNLTAPQAVELLQKR
LDVVFGEGEGVIRVFESDGILADAAAGADYIKIRSDALFNERDVRALEVHEGLVHVGTTL
NGQNQPICTFLAKGPPSSTVTQEGLAILMEVIAFASYPTRLRKLTNRTRAIHMAEEGADF
LDVFAFFREQGYGDDESYSNASRVFRGSTPDGLPFTKDLSYLKGFIMIYNYIQLAVRKGQ
LEQIPLLFCGKTTLEDMRTLRQLVDEGMVVPPKYLPQQFQDLNALSAWMCFSNFLNHLSL
DRIEADYANIL