Protein Info for PGA1_c15320 in Phaeobacter inhibens DSM 17395

Annotation: Predicted hydrolases of HD superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF12917: YfbR-like" amino acids 15 to 114 (100 residues), 28.3 bits, see alignment E=2.1e-10 amino acids 203 to 333 (131 residues), 44.7 bits, see alignment E=1.9e-15 PF13023: HD_3" amino acids 18 to 180 (163 residues), 144.2 bits, see alignment E=5.4e-46 amino acids 207 to 373 (167 residues), 169.6 bits, see alignment E=8.7e-54

Best Hits

KEGG orthology group: K07023, putative hydrolases of HD superfamily (inferred from 63% identity to sit:TM1040_1237)

Predicted SEED Role

"HD domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWP7 at UniProt or InterPro

Protein Sequence (390 amino acids)

>PGA1_c15320 Predicted hydrolases of HD superfamily (Phaeobacter inhibens DSM 17395)
MNDTSSRLESQFRFLLEADKLRRVDRQNLILDGSRCENSAEHSWHLALYALVLAPFAPAD
VSIERVVQMLLLHDLVEIDAGDHPIDGDVDWEAVASAEAVAATRLFSLLPADQSAFLHGL
WREFEASTTPDAQWAKRIDHCQPIFQTLYNADVPAAHIEVVRGNLYGGRAAALKDAFPEV
YSHAVAKLEGSDPQDVLTAPLAFLNEVDALKTVLRATTLGDGSRHENSAEHSWHIMLYAW
VLAQHSHAPVDMAKVLQMLMLHDIVEIDAGDVPIHSTLSEADHAAIAASEQAAAERIFAL
LPEDQGQAFRSIWEEFEAAESAEAVYAKAIDRVQPVLLNLMSGGGSWREYNVSLAQLEAR
VGQKVARGAPAVWDHVRATVAPWFAENTSA