Protein Info for PGA1_c15300 in Phaeobacter inhibens DSM 17395

Annotation: GTP-binding protein TypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00009: GTP_EFTU" amino acids 2 to 193 (192 residues), 186.3 bits, see alignment E=1.4e-58 TIGR01394: GTP-binding protein TypA/BipA" amino acids 3 to 600 (598 residues), 916.4 bits, see alignment E=6.3e-280 TIGR00231: small GTP-binding protein domain" amino acids 3 to 139 (137 residues), 86.9 bits, see alignment E=1.3e-28 PF01926: MMR_HSR1" amino acids 6 to 127 (122 residues), 24.7 bits, see alignment E=6.4e-09 PF22042: EF-G_D2" amino acids 211 to 289 (79 residues), 38.3 bits, see alignment E=3.6e-13 PF03144: GTP_EFTU_D2" amino acids 219 to 288 (70 residues), 38.1 bits, see alignment E=5.3e-13 PF00679: EFG_C" amino acids 398 to 482 (85 residues), 74.1 bits, see alignment E=2.3e-24 PF21018: BipA_C" amino acids 487 to 594 (108 residues), 159.1 bits, see alignment E=9e-51

Best Hits

Swiss-Prot: 54% identical to TYPA_HELPY: GTP-binding protein TypA/BipA homolog (typA) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K06207, GTP-binding protein (inferred from 93% identity to sit:TM1040_1235)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ71 at UniProt or InterPro

Protein Sequence (606 amino acids)

>PGA1_c15300 GTP-binding protein TypA (Phaeobacter inhibens DSM 17395)
MDLRNIAIIAHVDHGKTTLVDELLKQSGAFRENQAVAERAMDSNDLERERGITILAKATS
VEWNGTRINIVDTPGHADFGGEVERILSMVDGVVLLVDAAEGPMPQTKFVTSKALALGLR
PIVVVNKVDKPDGEPDRALDQCFDLFANLGADDDQLDFPTMYASGRSGWADMELDGPRKD
LSAMFQLIVDHVPAPKQIEHKNEPFRMLATTLGADPFMGRILTGRVESGTLKAGDNLKAL
SREGDLIENFRCTKVLAFRGLGQQAIDVAEAGDIVSIAGMTKATVADSLVDTSVSEALPA
QPIDPPTITVTFGINDSPLAGRDGKKVQSRVIRDRLMKEAESNVAIQISDTPGGEAFEVA
GRGELQMGVLIENMRREGFELSISRPQVLFKEEDGVRMEPVEEATIDVDDEYSGVVIEKL
TGHRKGELVEMKPAGVGKTRIIAHVPSRGLIGYHGEFLTDTRGTGVLNRVFHGWTPHKGS
IPGRRAGVLISMENGTSVAYALWNLEERGKMMIGAQEDVYTGMIIGEHSRDNDLEVNPLK
GKKLTNVRASGTDDAVRLTTPMKLSLEEAIAYIDDDELVEVTPNSVRLRKRYLDPHERKR
MARANA