Protein Info for HP15_1473 in Marinobacter adhaerens HP15

Annotation: flagellar basal body L-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02107: FlgH" amino acids 57 to 232 (176 residues), 201.3 bits, see alignment E=4.6e-64

Best Hits

Swiss-Prot: 56% identical to FLGH_HAHCH: Flagellar L-ring protein (flgH) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 85% identity to maq:Maqu_1108)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKE0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>HP15_1473 flagellar basal body L-ring protein (Marinobacter adhaerens HP15)
MKLMTTHRTVRSASTLVIVMLLILLQGCTAMSRPRAVPDDPEFAPVRPQAMMQRDSASGS
IYQVSRNYNFYGDTVALNVGDVLTVNLQESTSASKNAETSITKDNETTLPNPTILGKDNF
GINTSFNHERDFQGAAEADQSNSLAGSITVTVTEVLPNGVLRIRGEKWLSLTNGDEYIRL
TGLVRPQDIQPDNTVASNRIADARFAYGGTGDFDQANQMGWLARFFNSEWWPL