Protein Info for Psest_1543 in Pseudomonas stutzeri RCH2

Annotation: Predicted transcription regulator, contains HTH domain (MarR family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF13463: HTH_27" amino acids 57 to 122 (66 residues), 69.6 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: None (inferred from 88% identity to pmy:Pmen_3377)

Predicted SEED Role

"Predicted transcription regulator, contains HTH domain (MarR family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH90 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Psest_1543 Predicted transcription regulator, contains HTH domain (MarR family) (Pseudomonas stutzeri RCH2)
MVDAKSSRPLRSSIVASAHLAEQSQELSELEYGIIVASAALMRWMERCMQACGTVEMNAL
DVMVLHNLTSRGRAKRQADICLLLNVEDTHTVTYALKKLSKLGLVEGAKQGKEMFYRTTE
KGRALCQEYADIRRECLIASFENLNIDPDEIHRLAGMLRAMSGLYDQAARAATSL