Protein Info for Psest_1542 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized proteins, homologs of lactam utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF03746: LamB_YcsF" amino acids 6 to 245 (240 residues), 326.5 bits, see alignment E=5.5e-102

Best Hits

Swiss-Prot: 76% identical to PXPA2_PSEAE: 5-oxoprolinase subunit A 2 (pxpA2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07160, UPF0271 protein (inferred from 96% identity to psa:PST_2761)

Predicted SEED Role

"Lactam utilization protein LamB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJY3 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Psest_1542 Uncharacterized proteins, homologs of lactam utilization protein B (Pseudomonas stutzeri RCH2)
MGRLLLNCDIGESFGAWTMGLDAEVMPFIDCANIACGFHASDPQIMRRTVALARQHDVLI
GAHPAYPDLVGFGRRSMACSPAEVENMLLYQIGALDGLCRAEGTQVRYVKPHGALYNDMM
RQPELLRAVMSAIKAYAPSLPLMLMSTRDNNASQALAAEIGITLWFEVFADRAYDAAGML
VSRNLPGAVHHDAETVADQALRLAKGEALTASDGSALILQADTLCVHGDNAGSIAAVQRI
RQALQALPV