Protein Info for HP15_1470 in Marinobacter adhaerens HP15

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 306 (306 residues), 143.4 bits, see alignment E=7.4e-46 amino acids 320 to 614 (295 residues), 181.8 bits, see alignment E=1.6e-57 PF00460: Flg_bb_rod" amino acids 3 to 33 (31 residues), 37.1 bits, see alignment (E = 4.8e-13) PF22692: LlgE_F_G_D1" amino acids 83 to 139 (57 residues), 35.7 bits, see alignment 1.6e-12 PF07559: FlgE_D2" amino acids 360 to 513 (154 residues), 105.8 bits, see alignment E=5.6e-34 PF06429: Flg_bbr_C" amino acids 589 to 631 (43 residues), 51.2 bits, see alignment 1.4e-17

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 74% identity to maq:Maqu_1105)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKD7 at UniProt or InterPro

Protein Sequence (632 amino acids)

>HP15_1470 flagellar hook protein FlgE (Marinobacter adhaerens HP15)
MAFNTGLSGLRAASVDLDVTGNNIANASTVGFKGSKAQFGDLYASGFLSAGTNPIGDGVR
VQDVKQSFGQGNISFTDNGLDMAIAGDGFFILNNGGEIRYSRAGQFGIDKEGYVTNNQNM
RVQGYTADEDGNLSGIRGDLQIATDNLAPRRTTNLDSDLNLDSRESVLETRVRDVGPLTL
ASIQGESFDVQYSDGSPAFNVNIDPAASAREAASTINDAPGLSASATTTATFDGTPALDD
AFISGASSFSFSLDINGSPLTLDTSNINSLQDLVDSINNSSETAISASIVTGGGGSDVLR
VIHNQGETLDFTFADGNGNGDTGTVEGDVNVTADRSVAGITSTTADNDFEVAFNASPIRV
TNQFNPLDQRTYNHATSTTIYDSLGNSHELTQFFVKNPSPGNGVGVSEWSVYAQIDGEFV
GGTDVTPYTARFDQDGALQSIDGDPSGEIVIDDWIPKDSDGQPNGADGPPAAGEVVVTPI
PEPPTTSAFVINLSGTTQYGAAFGVNDQQQNGYTTGRLSGLDVSDQGVLFARYTNGQSQA
LGQVALASFNNTNGLSPVGDTSWVETFESGQPIIGAPDTGTLGSIKASSVEESNVDLSAE
LVNLIIAQRNYQANAKTIETSDAVTQTIINLR