Protein Info for PGA1_c15220 in Phaeobacter inhibens DSM 17395

Annotation: inosine-5'-monophosphate dehydrogenase GuaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 6 to 468 (463 residues), 520.2 bits, E=3.6e-160
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 6 to 449 (444 residues), 599.1 bits, E=2.8e-184
• PF00571: CBS
  • amino acids 94 to 139 (46 residues), 40.4 bits, 4.4e-14
  • amino acids 153 to 197 (45 residues), 23.9 bits, 6.5e-09
• PF03060: NMO
  • amino acids 207 to 370 (164 residues), 35.3 bits, E=1.4e-12

Best Hits

Swiss-Prot: 61% identical to IMDH_ECO57: Inosine-5'-monophosphate dehydrogenase (guaB) from Escherichia coli O157:H7

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 93% identity to sit:TM1040_1224)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• purine nucleotides degradation II (aerobic) (10/11 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See I7EWP2 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PGA1_c15220 inosine-5'-monophosphate dehydrogenase GuaB (Phaeobacter inhibens DSM 17395)
MQIREALTFDDVLLVPAASSVLPNTADTRTRVTGGISLNIPLLSSAMDTVTESRMAIAMA
QAGGMGVIHKNLDLEEQARQVRRVKRFESGIVYNPITLTADQTLADAKALQERYRVTGFP
VVDKEGRVVGIVTNRDMRFATDDNTPVSVMMTSDNLALLHEPAELEEAKSMMKSRRIEKL
LVTDGDGKLTGLLTLKDTEQAVLNPTACKDDLGRLRVAAASSVGDSGFARSEALIDAGVD
IVVVDTAHGHSEGVIEAVKRIKALSSGVQVVAGNVATAAATKALIDAGADAVKVGIGPGS
ICTTRMVAGVGVPQLTAIMDCASAAGDIPVIADGGIKFSGDFAKAIAAGASCAMVGSMIA
GTDESPGEVILYQGRSFKSYRGMGSLGAMARGSADRYFQKDAASDKLVPEGIEGQVAYKG
SAGAVIHQLVGGLRAAMGYTGCATVDEMRKNCEFVRITGAGLKESHVHDVQITRESPNYR
IG