Protein Info for PGA1_c15220 in Phaeobacter inhibens DSM 17395

Annotation: inosine-5'-monophosphate dehydrogenase GuaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF00478: IMPDH" amino acids 6 to 468 (463 residues), 520.2 bits, see alignment E=3.6e-160 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 6 to 449 (444 residues), 599.1 bits, see alignment E=2.8e-184 PF00571: CBS" amino acids 94 to 139 (46 residues), 40.4 bits, see alignment 4.4e-14 amino acids 153 to 197 (45 residues), 23.9 bits, see alignment 6.5e-09 PF03060: NMO" amino acids 207 to 370 (164 residues), 35.3 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 61% identical to IMDH_ECO57: Inosine-5'-monophosphate dehydrogenase (guaB) from Escherichia coli O157:H7

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 93% identity to sit:TM1040_1224)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWP2 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PGA1_c15220 inosine-5'-monophosphate dehydrogenase GuaB (Phaeobacter inhibens DSM 17395)
MQIREALTFDDVLLVPAASSVLPNTADTRTRVTGGISLNIPLLSSAMDTVTESRMAIAMA
QAGGMGVIHKNLDLEEQARQVRRVKRFESGIVYNPITLTADQTLADAKALQERYRVTGFP
VVDKEGRVVGIVTNRDMRFATDDNTPVSVMMTSDNLALLHEPAELEEAKSMMKSRRIEKL
LVTDGDGKLTGLLTLKDTEQAVLNPTACKDDLGRLRVAAASSVGDSGFARSEALIDAGVD
IVVVDTAHGHSEGVIEAVKRIKALSSGVQVVAGNVATAAATKALIDAGADAVKVGIGPGS
ICTTRMVAGVGVPQLTAIMDCASAAGDIPVIADGGIKFSGDFAKAIAAGASCAMVGSMIA
GTDESPGEVILYQGRSFKSYRGMGSLGAMARGSADRYFQKDAASDKLVPEGIEGQVAYKG
SAGAVIHQLVGGLRAAMGYTGCATVDEMRKNCEFVRITGAGLKESHVHDVQITRESPNYR
IG