Protein Info for Psest_1539 in Pseudomonas stutzeri RCH2

Annotation: Mn2+ and Fe2+ transporters of the NRAMP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 278 to 305 (28 residues), see Phobius details amino acids 317 to 333 (17 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details PF01566: Nramp" amino acids 80 to 391 (312 residues), 80.1 bits, see alignment E=8.2e-27

Best Hits

Swiss-Prot: 51% identical to YCSG_BACSU: Uncharacterized membrane protein YcsG (ycsG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 94% identity to psa:PST_2765)

Predicted SEED Role

"Mn2+/Fe2+ transporter, NRAMP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL89 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Psest_1539 Mn2+ and Fe2+ transporters of the NRAMP family (Pseudomonas stutzeri RCH2)
MQSTQAERGTPAQRNVLRGAIFIMATSSIGPAFLTQTSLFTEKYLASFAFAILISLLIDI
GAQLNIWRVITVANLRGQDVANRVIPGVGHLISALIVLGGIAFNIGNIGGAGLAMNVIFG
IPPLIGSLIAAVLIIGIFLLRNAKGVMDSVMQVLGLVMLCMIGYAMLQSNPPLLEAMSRS
FNPDDPLILLLPIVTLVGGTVGGYISFSGGHRLVEAGITGIENVKLVSRAAVIGIATTGV
VRICLFLAALGVVSQGLSLDPSNPAASVFSHSMGTIGYKIFGVVLLAASVSSVIGAAYTS
VTFMYSLHDSIQRHNQRMVIAFIACSTLIYSLVGQPVKVLVVAGTLNALVLPLALGCILL
ASRKASIVGDAYRHPTWMLVFGILAMLATAVGVVMSFNAFVQFWQS