Protein Info for Psest_0015 in Pseudomonas stutzeri RCH2

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF13428: TPR_14" amino acids 18 to 58 (41 residues), 29.3 bits, see alignment E=1.2e-10 PF07719: TPR_2" amino acids 20 to 49 (30 residues), 23 bits, see alignment E=8.9e-09 PF14559: TPR_19" amino acids 27 to 81 (55 residues), 28.5 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 73% identical to Y015_PSEAE: TPR repeat-containing protein PA0015 (PA0015) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 75% identity to avn:Avin_46510)

Predicted SEED Role

"Chaperone protein YscY (Yop proteins translocation protein Y)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GD36 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Psest_0015 Tetratricopeptide repeat. (Pseudomonas stutzeri RCH2)
MLESLEKMLSQGMDNPMLRFGLGKGYMDAGQPGRAAEHLRRCVELDPKYSAAWKLLGKAL
QADGDKPGAHQAWERGIAAANAQGDKQAEKEMSVFLRRLDRLTPD