Protein Info for HP15_1464 in Marinobacter adhaerens HP15

Annotation: adenylate/guanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 40 to 56 (17 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF05230: MASE2" amino acids 35 to 121 (87 residues), 68.7 bits, see alignment E=3.6e-23 PF00211: Guanylate_cyc" amino acids 240 to 417 (178 residues), 130.9 bits, see alignment E=4.3e-42

Best Hits

KEGG orthology group: None (inferred from 85% identity to maq:Maqu_1100)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKD1 at UniProt or InterPro

Protein Sequence (479 amino acids)

>HP15_1464 adenylate/guanylate cyclase (Marinobacter adhaerens HP15)
MMSAPADLRNASSSAGRALSSEAAGNPIAIPPMPDYNGRVLAYTSTAAIIVTGVLQGAFP
QWLLWLVAGALTWPHIAHALTRRTFLRNSPRIRQKMLIFDCVVGGAFIGCIGLIVIPSLA
VALMLMFSCLIVGGIRQWVLGTGFMAASIAGAVAIVGPADGPHSPLLTSIVSILSTGLYI
CVTAYYSHQQARALMLAKTQIQNQREQSIALSHKLSKYLSPQVWQSIFTGERDVRLETQR
KKLAVFFSDIKGFTELSEEMEPEALTELLNHYFNEMSEVALKYGGTIDKFVGDSIMVFFG
DPTSRGQREDAFACVSMAIEMRKHMKIMRQKWRSQGIKTPLEIRMGISTGYTTVGNFGAE
NRMDYTIIGKEVNLASRLESLAEPGEILVSYETFALIKDKIMCRDKGEITVKGFGKPVPI
YEVVDFRRDMGPNRSFLEHEHSGFAMYLDSDKITEKERQAILTALEDAADRLRREEDVS