Protein Info for HP15_1462 in Marinobacter adhaerens HP15

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 9 to 219 (211 residues), 119.4 bits, see alignment E=1.7e-38 PF12698: ABC2_membrane_3" amino acids 59 to 246 (188 residues), 34.8 bits, see alignment E=1e-12

Best Hits

Swiss-Prot: 62% identical to YADH_ECO57: Inner membrane transport permease YadH (yadH) from Escherichia coli O157:H7

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 90% identity to maq:Maqu_1098)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKC9 at UniProt or InterPro

Protein Sequence (257 amino acids)

>HP15_1462 ABC-type multidrug transport system, permease component (Marinobacter adhaerens HP15)
MTPQALFTAFSTIVVREIRRFTRIWAQTLLPPAVTMTLYFIIFGNLIGSRIGEMGGFDYM
SFIVPGLIMMSVITSSYANVVSSFFSMKFQRSIEELLVSPVPNWVILAGYVTGGMARGLG
IGLIVTLLSLAFTRLSIHNLPMMVLTVFLTSALFALGGFINAMLATKFDDISIVPTFVLT
PLTYLGGVFYSIDLLPGFWQGVSMANPILYMVNGFRYGILGVSDVNPFVSLGMILVFISV
LAFIALRMLERGKGIRH