Protein Info for Psest_1531 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 112 to 140 (29 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 423 to 443 (21 residues), see Phobius details amino acids 451 to 466 (16 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 343 (306 residues), 34.6 bits, see alignment E=1e-12 PF05977: MFS_3" amino acids 81 to 329 (249 residues), 28.2 bits, see alignment E=7e-11

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_2774)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH80 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Psest_1531 hypothetical protein (Pseudomonas stutzeri RCH2)
MSRISRGTGSPRSSSTDGPVARHSQFRLLGKRRFLPFFCTQLLGAFNDNVFKQALILAIL
FKLGTAADTSLLINLCALLFILPFFLFSALGGQFGERFEKAWLIRRIKFAEILIMLAGAL
GMLLGNLPLLLVVLFCMGTQSALFGPVKYSILPQQLAEDELVGGNALVEMGTFLAILGGT
IGAGVLMANEAYAELVAVSVVLIALAGYLASLAIPGGTAALPTLHMDWHVLRQSWRILRL
GFGQQRAVSRAMLGNSWFWFLGATYLTQIPAFAKDHLGGDESVVTLILTLFSVGIALGSL
LCERLSRHHVEIGLVPFGAIGLSLCGVLLWWHAGDHMTTAATISWLALLGEPSNWWVLAD
ILGLGIFGGLYIVPLYALIQSRSVVHERSRVVAANNILNALFMVMSAIIAIVLLVLLNLT
IPQLFLVVSLLSVLVCGALFIDVPEFIERFLLWSLGERLGGVLLAQLRLR