Protein Info for PGA1_c15020 in Phaeobacter inhibens DSM 17395

Annotation: D-beta-hydroxybutyrate dehydrogenase BdhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 6 to 193 (188 residues), 175.7 bits, see alignment E=1.6e-55 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 6 to 256 (251 residues), 356.7 bits, see alignment E=3e-111 PF08659: KR" amino acids 9 to 157 (149 residues), 38 bits, see alignment E=3.3e-13 PF01370: Epimerase" amino acids 9 to 121 (113 residues), 24.6 bits, see alignment E=3.2e-09 PF13561: adh_short_C2" amino acids 14 to 255 (242 residues), 182.9 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 37% identical to BACC_BACSU: Dihydroanticapsin 7-dehydrogenase (bacC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 86% identity to sit:TM1040_1342)

MetaCyc: 37% identical to dihydroanticapsin dehydrogenase (Bacillus subtilis)
RXN-16285 [EC: 1.1.1.385]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30 or 1.1.1.385

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELU6 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PGA1_c15020 D-beta-hydroxybutyrate dehydrogenase BdhA (Phaeobacter inhibens DSM 17395)
MTLSGKCAVITGSNSGIGLGVAREMARAGADVVLNSFTDRDEDHALAAEIAAEFGVEARY
IQADMSDAEACRALITTSGRCDILINNAGIQHVAPVDEFPVDKWNAILAINLSSAFHTAA
AALPMMRGAGWGRVINIASAHGLTASPYKSAYVAAKHGVVGLTKTLALETAEEPITANAI
CPGYVLTPLVEAQIPDTMEKYNMGREEVIKKVMLERQPSREFATVEQLGGTAVFLCSDAA
AQMTGTTLSVDGGWTAL