Protein Info for PGA1_c15000 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12840: HTH_20
  • amino acids 12 to 62 (51 residues), 33.3 bits, 3.8e-12
• PF01451: LMWPc
  • amino acids 117 to 250 (134 residues), 64 bits, E=2e-21

Best Hits

KEGG orthology group: None (inferred from 58% identity to sit:TM1040_0526)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (2/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (3/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See I7DQ53 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PGA1_c15000 putative transcriptional regulator (Phaeobacter inhibens DSM 17395)
MEIEITSQLSALAHPNRLALFRLLMRRYPDAVPAGEIAAALAQKANTVSSYLSTLSAVGL
IRAERQGTSLLYRAQLDGLRNLFDDLLSDCCHNRPDICPPTVAQTPLLPGSDRPLNVLFI
CTGNSARSIMAEAILQQHSDGRFHAYSAGSRPSPAPRPEVLSLLRANGHETGGLRSKDLS
EFSGDDAPPMDFIFTVCDHAANEDCPAWPGQPMSAHWGLPDPVKAKGREAERRLAYQQTY
DALRNRIRSFAALPYETLDRISLQHRLDDIGRHTPSE