Protein Info for PGA1_c14980 in Phaeobacter inhibens DSM 17395

Annotation: putative major intrinsic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 61 (25 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF00230: MIP" amino acids 3 to 146 (144 residues), 79.5 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 59% identity to mno:Mnod_5684)

MetaCyc: 53% identical to aquaglyceroporin (Sinorhizobium meliloti)
TRANS-RXN0-551

Predicted SEED Role

"Aquaporin Z"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0F8 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PGA1_c14980 putative major intrinsic protein (Phaeobacter inhibens DSM 17395)
MTTQKLIAEALGTGFLLIGVVGSGIMAETLSGGNIGLALLANAVATGAMLYVIITTLGPI
SGAHFNPAVTLAFALRGDHSWAAVPPYVAAQIIGGILGVWASHVMFDLTILQTSTTMHRT
GGAQWFSEILATFGLLFVIFGGLRSRPEAVPALVAFYITGAYWFTASTSFANPAVTVARG
FSDTFAGIYPGHILMFIVMQFIGVGLAHLILPRLFRPS