Protein Info for Psest_1513 in Pseudomonas stutzeri RCH2

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00578: AhpC-TSA" amino acids 6 to 133 (128 residues), 107.9 bits, see alignment E=3.4e-35 PF08534: Redoxin" amino acids 8 to 140 (133 residues), 44.4 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 56% identical to BCP_XANCP: Peroxiredoxin Bcp (bcp) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 91% identity to psa:PST_2792)

MetaCyc: 37% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJA6 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Psest_1513 Peroxiredoxin (Pseudomonas stutzeri RCH2)
MAVEIDRPVPPFQAQATSSQLVDLESLAGRQVVLYFYPKDNTPGCTTQGQGFRDQHPAFL
AANTLVFGVSRDSLKTHENFRTKQGFPFELISDKDEQLCQLFDVIKLKKLYGKEYLGVDR
STFLIDRSGVLRQEWRGVKVPGHVEAVLQAAQALNDA