Protein Info for Psest_1512 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 244 to 270 (27 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 307 to 335 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 22 to 346 (325 residues), 229.9 bits, see alignment E=2.6e-72

Best Hits

KEGG orthology group: K03548, putative permease (inferred from 76% identity to pmy:Pmen_1660)

Predicted SEED Role

"Putative permease PerM (= YfgO)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL01 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Psest_1512 Predicted permease (Pseudomonas stutzeri RCH2)
MIKVLRGWMQRYFSDEEAVVLAVLLFLAFAAVLTLGKMLAPVLAGLVLAFLMQGLVGTLE
RLRVPHLVAVWLVFLMFIGVMVVCTLFIVPLLWQQLLTLFNELPRMLVEWQSLLLLLPER
YPQLVTEEQVLRGIDFMRGEIGRYGQVVLTSSLSSLPLLIGLMIYLVLVPILVFFFLKDR
QQISDWIKGYLPRERGLITQVSQEMNLQIANYIRGKVIEILIVAVVSYAVFAALGLNYAA
LMAMLVGISVVVPYIGATVVTIPIALIGIFQWGLGDQFFYLMVAYAIIQTLDGNVLVPLL
FSEAVNLHPVAIICAVLLFGGLWGFWGVFFAIPLATLFKAVLYAWPREPAAVVVAPSE