Protein Info for Psest_1511 in Pseudomonas stutzeri RCH2

Annotation: Predicted redox protein, regulator of disulfide bond formation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01206: TusA
  • amino acids 14 to 82 (69 residues), 80.1 bits, E=4.2e-27

Best Hits

Swiss-Prot: 49% identical to TUSA_PSEE4: Sulfur carrier protein TusA (tusA) from Pseudomonas entomophila (strain L48)

KEGG orthology group: None (inferred from 92% identity to psa:PST_2794)

MetaCyc: 49% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"Rhodanese-like domain protein"

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)

Sequence Analysis Tools

See L0GL67 at UniProt or InterPro

Protein Sequence (83 amino acids)

>Psest_1511 Predicted redox protein, regulator of disulfide bond formation (Pseudomonas stutzeri RCH2)
MTDEQSQSLVHDAEVDAVGLDCPMPLLKAKLELNRLASGAVLKVIASDPGSQRDFRSFAK
LAGHALLREETEDGVYRYWLRKA