Protein Info for PGA1_c14930 in Phaeobacter inhibens DSM 17395

Annotation: putative MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 364 (345 residues), 130.7 bits, see alignment E=6.5e-42 PF00083: Sugar_tr" amino acids 51 to 191 (141 residues), 31 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 68% identity to sil:SPO2071)

Predicted SEED Role

"MFS family multidrug efflux protein, similarity to bicyclomycin resistance protein Bcr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0F4 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PGA1_c14930 putative MFS transporter (Phaeobacter inhibens DSM 17395)
MTKDIQISMSKAEFIALIAMMFATVAFSIDAMLPALPEIGQTLSADNPNRAQLVIATFAL
GMGIGTFFTGPLSDAFGRRSVIFAAAGLYIAAALLAYASSSIEMLLLSRVVMGLAAAGPR
VVALAIVRDLYSGREMARMMSIAMLIFTLVPAIAPMMGAGIILLTSWRAIFLAFALFAVV
IVLWMGLRLPEPLPAENRRPFRLPNLQAALIEMLRHPTVRLSMMVQCFCLAMLFCMITLV
QPIYDVVFDRADSFPFWFGFIAVMSGSSSLINASLVVRLGMRRMVTWALAGQIIFSALML
GLEVLPLSGDLMFALFVAWQTSVFFMAGLTLGNLNAMAMEPMGHIAGMAASIVGGVSTVF
AAAAAATVGLLFDGSIAPLTGAILLMVIAGYAIMLHMARVENRVAAE