Protein Info for PGA1_c14900 in Phaeobacter inhibens DSM 17395

Annotation: delta-aminolevulinic acid dehydratase HemB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00490: ALAD" amino acids 11 to 328 (318 residues), 455 bits, see alignment E=6.9e-141

Best Hits

Swiss-Prot: 62% identical to HEM2_BRADU: Delta-aminolevulinic acid dehydratase (hemB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01698, porphobilinogen synthase [EC: 4.2.1.24] (inferred from 85% identity to sil:SPO2076)

Predicted SEED Role

"Porphobilinogen synthase (EC 4.2.1.24)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQ44 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PGA1_c14900 delta-aminolevulinic acid dehydratase HemB (Phaeobacter inhibens DSM 17395)
MKPTVAPFPAARPRRLRSAPALRNLVRETTLTSDDLIWPVFVRDGEAIEEPIPSMPGVTR
RSIDKVVEAAIEAQALGIPAICLFPYTDPALKTEDCAEAWSPDNLVNRAIRAIKSAAPDL
AVMTDVALDPYNINGHDGYVVDGEIVNDETVEALVKMTVAQADAGADIIGPSDMMDGRIG
AMRRALEAAGHRNVTILSYAAKYASAYYGPFRDAVGASGALKGDKKTYQMDPGNTDEALR
MIERDLSEGADMVMIKPGLAYLDICQRVKSTFGAPTFAYQVSGEYAMIEAAAQNGWIDGE
RIMMESLMAFKRAGCDGVLTYYAPAAARLLNG