Protein Info for Psest_1505 in Pseudomonas stutzeri RCH2

Annotation: Organic radical activating enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR04349: putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE" amino acids 14 to 224 (211 residues), 367.5 bits, see alignment E=1e-114 PF04055: Radical_SAM" amino acids 40 to 128 (89 residues), 54.4 bits, see alignment E=9.1e-19

Best Hits

Swiss-Prot: 44% identical to QUEE_KORVE: 7-carboxy-7-deazaguanine synthase (queE) from Koribacter versatilis (strain Ellin345)

KEGG orthology group: K10026, queuosine biosynthesis protein QueE (inferred from 96% identity to psa:PST_2800)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL61 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Psest_1505 Organic radical activating enzymes (Pseudomonas stutzeri RCH2)
MACLAVTPVADMTLRITEIFYSLQGETRTSGLPTVFVRLTGCPLRCQYCDTAYAFSGGEL
MSIDAIVERVAAYNPRYVCVTGGEPLAQPNCVPLLQRLCDAGYEVSLETSGALDISVVDE
RVSRVVDLKTPGSAEVARNRYENIASLTQNDQVKFVICSREDYDWAVSKLIEYGLDRRAG
EVLFSPSHGQVDVRALADWIVADNLPVRLQLQLHKIIWNDAPGH