Protein Info for PGA1_c14800 in Phaeobacter inhibens DSM 17395

Annotation: nitrogen regulation protein NtrY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 759 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details PF19312: NtrY_N" amino acids 54 to 301 (248 residues), 92.7 bits, see alignment E=9.5e-30 PF00672: HAMP" amino acids 325 to 378 (54 residues), 56.6 bits, see alignment 9.4e-19 TIGR00229: PAS domain S-box protein" amino acids 392 to 508 (117 residues), 28.6 bits, see alignment E=6.7e-11 PF00989: PAS" amino acids 397 to 500 (104 residues), 41.6 bits, see alignment E=4e-14 PF08448: PAS_4" amino acids 406 to 503 (98 residues), 26.3 bits, see alignment E=2.6e-09 PF13188: PAS_8" amino acids 407 to 451 (45 residues), 20.1 bits, see alignment 1.7e-07 PF00512: HisKA" amino acids 513 to 580 (68 residues), 40.5 bits, see alignment E=8.1e-14 PF02518: HATPase_c" amino acids 624 to 742 (119 residues), 65.7 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 77% identity to sit:TM1040_1360)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQ32 at UniProt or InterPro

Protein Sequence (759 amino acids)

>PGA1_c14800 nitrogen regulation protein NtrY (Phaeobacter inhibens DSM 17395)
MAQRSHLRSAYGPFAALDRWRRTRRARNVGALGLVVLGPVLALSTFLIIGPFSQGVASLS
LRLILLADLIYVLAVAALVLTQVGRLIAARRAKSAGSRLHLRLIGAFAFLALTPTVIVAL
FAGLTVNVGLEGWFSDRVRQVVGSSLAAAEAYQDQQQRDLSEDAVALARYIDNSRNRNFF
ISDGQLRQVLTQGQLQIQRGLQEAYVVDGAGTIRARGERSYEFDFEEPRTADISQASFEG
VTLIQDWDNSELRALVRLDAFVDRFLYVSRDVDGELLSLLDDTKETAHLYQQLESERGRV
LFDFVLLYLGFAVILILAAMWLGMWFAERLSRPVGRLTIAARRVGAGNLNVQVPEDDGDD
EISQLGRYFNQMTLELREQRDTLLENTHQIERRRRLFDSVLMSVTSGVVGLDSEGRVTFV
NRSAERLLGWSGDRQSLALAVAVPEFGPLFQELTETGADVVQGEIKVTRQGQLENLLVRM
SPRRSEEDRLEGYVVAFDDVTDLVSAQRMAAWGDVARRIAHEIKNPLTPIQLSAERIKRK
FAPKLGEENSDLLQSMTDVIVRQTNDLRRIVDEFSKFARMPEPERREEDLVKLLREAVTL
QKAGQPDLRIVADLPTEPMLADLDATMIGQALTNLIKNAGEAVETLKQKGTVPDLDPEIR
IAVSPTKSGYEVTIADNGIGLPEDRARLFEPYVTTRDEGTGLGLPIVKKIIEEHGGTLAL
EDAPVFDGQAHYGAMAVIRLPAAHEAAVHHKSTVKAGLT