Protein Info for PGA1_c14780 in Phaeobacter inhibens DSM 17395

Annotation: nitrogen regulation protein NtrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF08448: PAS_4" amino acids 19 to 111 (93 residues), 28.9 bits, see alignment E=2.4e-10 PF00512: HisKA" amino acids 141 to 196 (56 residues), 45.1 bits, see alignment 1.7e-15 PF02518: HATPase_c" amino acids 242 to 357 (116 residues), 75.1 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 64% identical to NTRB_RHOCB: Sensory histidine kinase/phosphatase NtrB (ntrB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 79% identity to sit:TM1040_1362)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0D7 at UniProt or InterPro

Protein Sequence (376 amino acids)

>PGA1_c14780 nitrogen regulation protein NtrB (Phaeobacter inhibens DSM 17395)
MAGSGATQNWNGADSALWASLPVPAFVIDPEARIEDVNSAGEGFLNTSRKALLGKAIWQH
VIIAPAIDEAVARARDNGTPLFVNDIDVGAPGRAPLQCNVQVARVQGVEGRMLILLSPRE
LAGRLTQNHSAKSAAQSAIGMAEMLAHEIKNPLAGITGAAQLLSMGLSGDDLELTDLIVS
ESRRIVKLLEQVEQFGNLSTLAFQEVNIHDVLDRARRSALLGFGAHMTIIEDYDPSLPMA
WGDGDQLLQVVLNLLKNAAEAADPGGGTIRIRTFYEHSFRLRRSDGSGKLLPLQIEISDD
GPGLPEAIRDDIFDPFVSGRENGTGLGLALVSKIIADHQGWISVNSEPGQTVFRLSLSRV
PTAPRPVPIPNAPRQE