Protein Info for PGA1_c14770 in Phaeobacter inhibens DSM 17395

Annotation: tRNA-dihydrouridine synthase DusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 6 to 317 (312 residues), 363.2 bits, see alignment E=5.8e-113 PF01207: Dus" amino acids 16 to 316 (301 residues), 336.5 bits, see alignment E=7.2e-105

Best Hits

Swiss-Prot: 62% identical to DUS_RHOCB: Probable tRNA-dihydrouridine synthase (dus) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: None (inferred from 82% identity to sit:TM1040_1363)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELS1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PGA1_c14770 tRNA-dihydrouridine synthase DusB (Phaeobacter inhibens DSM 17395)
MSFTLGSTSLTPPIALAPMAGITDRPFRDLVRSFGAGLMVSEMVASQEMVQAKPGVRERA
ELSADVENTAVQIAGRDAYWMAEAARQVESRGAKVIDINMGCPAKKVTNGYSGSALLKTP
DHALSLIEAVVAAVSVPVTLKTRLGWDDNSLNAADVARRAQDAGVQMVTIHGRTRCQFYK
GTADWKAIAAVKTALNVPLLANGDIVDTATARTALAQSGADGVMIGRGVQGKPWLLAEVA
HDIWGSAAPEVPTGSDLVQMVSAHYEAMIAFYGTDLGLRVARKHLGWYMDEAATPAPLRR
EVLTAKAPKTVLQLLPDALIGGAGPDRGPDLAAGQAA