Protein Info for Psest_1491 in Pseudomonas stutzeri RCH2

Annotation: Cold shock proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details PF00313: CSD" amino acids 137 to 199 (63 residues), 87 bits, see alignment E=3e-29

Best Hits

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 85% identity to psa:PST_2815)

Predicted SEED Role

"Cold shock protein CspC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKY5 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psest_1491 Cold shock proteins (Pseudomonas stutzeri RCH2)
MLKIVHVLAGVIALLLSFVPSLRGAMPLLLQPEALCLLMLGLLNVQFAPSAQLIDARTRP
TLIAASVLLLISIALQSFIVLVSLPEIAGQPATLASLLLAFIAVLLHLATPQAQRAQPKP
ARKPAGTSAPSAAGREAGTVKWFNTSKGFGFISRDSGDDVFVHFRAIRGEGHRVLVEGQR
VEFSIMMRDKGLQAEDVVPVESDR